Recombinant Rat Metalloproteinase inhibitor 1 (Timp1)

Code CSB-RP167194r
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Timp1
Uniprot No.
Research Area
Others
Alternative Names
Timp1; Timp-1; Metalloproteinase inhibitor 1; Tissue inhibitor of metalloproteinases 1; TIMP-1
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
24-217aa
Target Protein Sequence
CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
25.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Also stimulates steroidogenesis by Leydig and ovarian granuloma cells; procathepsin L is required for maximal activity.
Gene References into Functions
  1. Tissue kallikrein 1 and TIMP1 expressed in a coexpression vector synergistically inhibited the proliferation of rat vascular smooth muscle cells. PMID: 26252163
  2. In a normoglycemic rat model of wound healing, pentoxifylline significantly increased TIMP-1 gene expression. PMID: 26087281
  3. Our findings clearly demonstrate that despite their dramatic spatial rearrangement, cones and second-order neuron processes maintain their synaptic connections before and after TIMP-1 treatment. PMID: 26277580
  4. Data indicate that adiponectin promoted tissue inhibitor of metalloproteinase-1 (TIMP-1) expression and limited hepatic stellate cell migration . PMID: 25575598
  5. Basic fibroblast growth factor could up-regulate TIMP-1 expression and down-regulate MMP-9 activation in CFs in perivascular spaces, leading to inhibited progression of cardiac fibrosis during hypertensive heart failure. PMID: 24322055
  6. Acute and chronic elevated laminar shear stress act to maintain vessel integrity through increasing TIMP-1 production, and the TGFbeta signaling pathway is essential to maintain TIMP-1 expression during chronic shear stress. PMID: 24471921
  7. Inducible TIMP1 can modulate the expression of fibrosis-related genes in the liver. PMID: 23456624
  8. Data indicate that increased TIMP-1 levels inhibit the proteolytic processing of Reelin under epileptic conditions. PMID: 23493620
  9. study aimed to identify genomic biomarkers for early and sensitive detection of renal papillary injury in rats; Timp1, Igf1, and Lamc2 exhibited the best prediction performance PMID: 23142791
  10. TIMP-1 increased in the rats treated with doxycycline ahead and might compensate for the activity of MMP-9 in lung injury following cardiopulmonary bypass. PMID: 22449799
  11. Recombinant human TIMP-1 is distributed quickly into rat ischemic brain tissue and is slowly eliminated in both blood and brain tissue of rats. PMID: 21535944
  12. Data show that the protein and mRNA expression level of TIMP-1 was high in asthmatic rat's lung tissues. PMID: 16191269
  13. Dahuang Zhechong Pill can down-regulate the expressions of TIMP-1 and PAI-1 mRNAs in renal tissues of rats with focal segmental glomerulosclerosis. PMID: 18471418
  14. higher levels of MMP-9 messenger RNA and protein expression were detected in the diabetic group compared with the control group (P < .05), and expression of TIMP-1 messenger RNA and protein was significantly decreased. PMID: 19917734
  15. TIMPs are involved in cell viability and tissue remodelling in the ischemic brain PMID: 11860503
  16. role of TIMP-1 in the airway extracellular matrix (ECM) remodelling of chronic obstructive pulmonary disease (COPD) rat models PMID: 12137602
  17. TIMP-1 induction by ANG II in aortic smooth muscle cells occurs in the absence of histological changes at the vascular wall. PMID: 12388255
  18. tissue inhibitor of metalloproteinase-1 mRNA was observed surrounding the developing corpus luteum (CL), with less intense expression present in granulosa-lutein cells PMID: 12444073
  19. oxidative stress-stimulated up-regulation of TIMP-1 may play an important role in the deposition of collagen or extracellular matrix elements in the glomeruli during hyperhomocysteinemia. PMID: 12631082
  20. TIMP-1 expression increased transiently but significantly during junction assembly in Sertoli cells and germ cells PMID: 12826691
  21. An imbalance between collagenases and TIMPs, excessive gelatinolytic activity, and epithelial apoptosis participate in the fibrotic response in this experimental model. PMID: 12882763
  22. TIMP1 gene transcription is regulated by RUNX1 and RUNX2 PMID: 15051730
  23. Administration of anti-TIMP-1 resulted in a marked decrease in alpha-SMA staining. TIMP-1 antibody attenuated CCl(4)-induced liver fibrosis and decreased hepatic stellate cell activation and MMP-2 activity. PMID: 15389776
  24. PANC-1 CM stimulates PSC proliferation and TIMP-1 through the MAP kinase (ERK 1/2) pathway. PMID: 15451430
  25. TIMP-1 may play an important role in the process of liver aging PMID: 15968723
  26. NO by induction of the Smad signaling pathway modulates TIMP-1 expression. PMID: 16183640
  27. In immune-induced model of rat liver fibrosis, serum TIMP-1 level could reflect severity of liver fibrosis, while in CCL4-induced model, the correlation between the serum TIMP-1 level and the severity of hepatic fibrosis was not statistically significant PMID: 16718785
  28. suggests a novel extracellular mechanism of late long-term potentiation in the PFC, engaging TIMP-1-controlled proteolysis as an element of information integration PMID: 17210139
  29. Expression of Timp1 was decreased by treatment with the protective agent from Aspergillus. PMID: 17485851
  30. Shear stress-induced Ets-1 modulates TIMP-1 expression in microvascular endothelial cells. PMID: 18636553
  31. Gene expression of Timp1 fibroblasts from the medial collateral ligament, anterior cruciate ligament and patellar tendon was not significantly different. PMID: 18807189
  32. W256 cells do not express or secrete TIMP-1 protein, although RT-PCR analysis indicated low-level TIMP-1 mRNA expression. PMID: 19330523
  33. Increased expression of TIMP-1 in venous endothelium and plasma may serve as an early indicator of endothelial dysfunction. PMID: 19467832
  34. These data are the first to show that the elevated vascular expression of TIMP-1, associated with breakdown of the blood-brain barrier following focal ischemia, are transcriptionally regulated via the MEK/ERK pathway. PMID: 19497125

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Protease inhibitor I35 (TIMP) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*